PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013609055.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 336aa    MW: 37671.8 Da    PI: 7.3409
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013609055.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding574.5e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l+++++++G g+W+++++  g+ R++k+c++rw +yl
   XP_013609055.1 14 KGLWSPEEDEKLLRYITKYGHGCWSSVPKQAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding45.12.2e-1467110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E+ l++++++ lG++ W+ Ia+ ++ gRt++++k+ w++
   XP_013609055.1  67 RGAFSQDEENLIIELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                      89********************.*********.*********9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.1E-28664IPR009057Homeodomain-like
PROSITE profilePS5129425.666965IPR017930Myb domain
SuperFamilySSF466898.24E-3012108IPR009057Homeodomain-like
SMARTSM007171.1E-131363IPR001005SANT/Myb domain
PfamPF002494.1E-161461IPR001005SANT/Myb domain
CDDcd001673.24E-121761No hitNo description
Gene3DG3DSA:1.10.10.603.6E-2565116IPR009057Homeodomain-like
PROSITE profilePS5129420.20166116IPR017930Myb domain
SMARTSM007176.0E-1366114IPR001005SANT/Myb domain
PfamPF002492.9E-1367110IPR001005SANT/Myb domain
CDDcd001672.83E-969112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLRYIT KYGHGCWSSV PKQAGLQRCG KSCRLRWINY  60
LRPDLKRGAF SQDEENLIIE LHAVLGNRWS QIAAQLPGRT DNEIKNLWNS SLKKKLRLRG  120
IDPVTHKLLA EIETGTDDNT TPVEKCQTTY LIETEGSSST TTGSTNHNNS NTDHLYTGNF  180
GFQRLSLETG SRIQTGIWIP QTGRNHHVDT VPSAVVLPGS MFSSGLTDST TGYRSSNLGL  240
TELDNSFSTG PMITEQHLQE SNYNNSTFFG TGNLSWGLTM EENQFTISNN SLQNHSNSSL  300
YSEIKSETNF FGTEAANVGM WPCNQLQPQQ HAYGHI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-29121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00427DAPTransfer from AT4G01680Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013609055.10.0PREDICTED: transcription repressor MYB6
RefseqXP_013722795.10.0PREDICTED: transcription repressor MYB6-like
TrEMBLA0A078F2H70.0A0A078F2H7_BRANA; BnaCnng01390D protein
TrEMBLA0A0D3DZW40.0A0A0D3DZW4_BRAOL; Uncharacterized protein
STRINGBra036317.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01680.10.0myb domain protein 55